Skip to content
Surf Wiki
Save to docs
arts

From Surf Wiki (app.surf) — the open knowledge base

Marty Robbins

American country singer (1925–1982)

Marty Robbins

Summary

American country singer (1925–1982)

FieldValue
nameMarty Robbins
imageMarty Robbins 1966.JPG
captionRobbins in 1966
birth_nameMartin David Robinson
birth_date
birth_placeGlendale, Arizona, U.S.
death_date
death_placeNashville, Tennessee, U.S.
occupation
years_active1948–1982
spouse
children2
signatureMarty Robbins signature.svg
module{{Infobox musical artistembed=yes
instrument
discographyMarty Robbins discography
genre
label
website

Early life

Billboard]]'' advertisement, April 20, 1957
The F.M. Staggs/Marty Robbins House in Glendale, Arizona

Robbins was born Martin David Robinson on September 26, 1925, in Glendale, a suburb of Phoenix in Maricopa County. His parents, John "Jack" Robinson (1889–1975) and Emma Heckle (1889–1970) divorced in 1937 when Robbins was 12 years old.

Among the warmer memories of his childhood, Robbins recalled having listened to stories of the American West told by his maternal grandfather, "Texas Bob" Heckle (1847-1931), who was a traveling salesman, raconteur, and local medicine man. Robbins later recalled: "He had two little books of poetry he would sell. I used to sing him church songs and he would tell me stories. A lot of the songs I've written were brought about because of stories he told me. Like 'Big Iron' I wrote because he was a Texas Ranger. At least he told me he was."

Robbins dropped out of high school in Glendale before his time in the Navy, and worked as an amateur boxer, dug ditches, drove trucks, delivered ice, and served as a mechanic's helper.

At 17, Robbins left home to serve in the U.S. Navy as an LCT coxswain during World War II. He was stationed in the Solomon Islands in the Pacific theater. To pass the time during the war, he learned to play the guitar, started writing songs, and came to love Hawaiian music.

After his discharge from the military in 1947 and his marriage the following year, Robbins began to play at local venues in Phoenix, In the early 1950s, Marty moved on to host his own show on KTYL and then his own television show Western Caravan on KPHO-TV in Phoenix. After Little Jimmy Dickens made a guest appearance on Robbins' TV show, Dickens got Robbins a record deal with Columbia Records.

Career

Robbins became known for his appearances on the* Grand Ole Opry* in Nashville. Music journalist Mary Harron wrote this about him in The Guardian:

Robbins was a symbol of the Nashville establishment that younger country fans abandoned in the '70s for the bleached-denim "outlaw school" of Waylon Jennings and Willie Nelson. Robbins belonged to the Jim Reeves era, and wore his embroidered cowboy suits proudly. Best known for the Western ballad, "El Paso", his career also touched the rock 'n' roll side of country in songs like "White Sport Coat and a Pink Carnation", and he kept a touch of the dude about him to the end.

In 1980, Robbins appeared on the PBS music program Austin City Limits (season five). In addition to his recordings and performances, Robbins was an avid race car driver, competing in 35 career NASCAR Grand National Series races with six top-10 finishes, including the 1973 Firecracker 400. In 1967, Robbins played himself in the car-racing film Hell on Wheels. Robbins was partial to Dodges prepared by NASCAR Hall-of-Famer Cotton Owens, and owned and raced Chargers and then a 1978 Dodge Magnum. He was also the driver of the 60th Indianapolis 500 Buick Century pace car in 1976. His last race was in a Junior Johnson-built 1982 Buick Regal in the Atlanta Journal 500 on November 7, 1982, a month before his death.

Music and honors

Although by 1960, Robbins' output was largely Western (and some country) music, his initial hits, such as "Singing the Blues", "Knee Deep in the Blues", "The Story of My Life", "She Was Only Seventeen", and "A White Sport Coat and a Pink Carnation", were generally regarded as more pop/teen idol material than his hits from 1960 onwards ("El Paso", etc.). In 1957, he wrote and recorded "A White Sport Coat and a Pink Carnation" which sold over one million copies, and was awarded a gold record.{{cite book | url-access= registration His musical accomplishments include the Grammy Award for his 1959 hit and signature song "El Paso", taken from his album Gunfighter Ballads and Trail Songs. "El Paso" was his first song to hit number one on the pop chart in the 1960s. It was followed up, successfully, by "Don't Worry", which reached number three on the pop chart in 1961, becoming his third, and last, top-10 pop hit. "El Paso" was followed by one prequel and one sequel: "Faleena (From El Paso)" and "El Paso City". Also in 1961, Robbins wrote the words and music and recorded "I Told the Brook", a ballad later recorded by Billy Thorpe.

He won the Grammy Award for the Best Country and Western Recording 1961 for his follow-up album More Gunfighter Ballads and Trail Songs, and was awarded another Grammy, for Best Country Song, in 1970, for "My Woman, My Woman, My Wife". Robbins was named Artist of the Decade (1960–1969) by the Academy of Country Music, was elected to the Country Music Hall of Fame in 1982, was given three awards at the 17th Annual Music City News Country Awards in 1983, and was given a Grammy Hall of Fame Award in 1998 for "El Paso".

When Robbins was recording his 1961 hit "Don't Worry" at the Bradley Studios in Nashville, session guitarist Grady Martin accidentally created the electric guitar "fuzz" effect – his six-string bass was run through a faulty channel in the studio's mixing console. Robbins decided to keep it in the final version. The song reached number one on the country chart, and number three on the pop chart. Robbins was inducted into the Nashville Songwriters Hall of Fame in 1975. For his contribution to the recording industry, Robbins has a star on the Hollywood Walk of Fame at 6666 Hollywood Boulevard.

Robbins has been honored by many bands, including the Grateful Dead, who covered "El Paso" and Bob Weir and Kingfish, who covered "Big Iron". The Who's 2006 album Endless Wire includes the song "God Speaks of Marty Robbins". The song's composer, Pete Townshend, explained that the song is about God deciding to create the universe just so he can hear some music, "and most of all, one of his best creations, Marty Robbins." The Beasts of Bourbon released a song called "The Day Marty Robbins Died" on their 1984 debut album The Axeman's Jazz. Both Frankie Laine and Elvis Presley, among others, recorded versions of Robbins' song "You Gave Me a Mountain", with Laine's recording reaching the pop and adult contemporary charts in 1969. Though Elvis never recorded any of Robbins' songs in the studio, he was a big fan and recorded "You Gave Me a Mountain" live in concert several times; it appeared on 15 Presley albums. Johnny Cash recorded a version of "Big Iron" as part of his American Recordings series, which is included in the Cash Unearthed box set. Cash also recorded other songs by Robbins, including "I Couldn't Keep from Crying", "Kate", and "Song of the Patriot". He held Robbins in high esteem, having him guest-star several times on his network TV show. "Big Iron" was also covered by Mike Ness on his album Under the Influences, on which he paid homage to country music artists. The song, originally released on Robbins' 1959 album Gunfighter Ballads and Trail Songs, gained renewed popularity following its use in the 2010 video game Fallout: New Vegas.

His song "El Paso" was featured in the series finale of the AMC TV series Breaking Bad. "El Paso" was also featured in the Only Fools and Horses prequel made by the BBC.

Robbins was awarded an honorary degree by Northern Arizona University.

In 2001, singer-songwriter Don McLean released his album, Sings Marty Robbins, which features a collection of songs recorded by Robbins in his career.

In 2016, a portion of Glendale Avenue in Robbins' hometown of Glendale, Arizona, was renamed "Marty Robbins Boulevard".

Before Robbins died, he held a performance at the White House, alongside famous American singer Frank Sinatra.

He was named Man of the Decade by the Academy of Country Music in 1970.

Political views

Robbins' political views remained firmly right-wing during his lifetime. During the 1960s, as the opposition to the Vietnam War strengthened, Robbins' political views turned to the right. He supported Barry Goldwater in his 1964 United States presidential election campaign as a southern director for "Stars for Barry". Two of his songs, "Ain't I Right" and "My Own Native Land", written in the 1960s, later became popular songs during the conservative resurgence in the 1980s. The lyrics of "Ain't I Right" describe antiwar protesters as fifth columnists and communists. After Columbia Records refused to publish his more politically charged songs, Robbins' band member Bobby Sykes recorded the songs for Sims Records under the name Johnny Freedom.

Racing career

Robbins loved NASCAR racing. With his musical successes, he was able to finance his avocation. Robbins always tried to run at the big racetracks (Talladega Superspeedway, Daytona International Speedway) every year and a smattering of the smaller races when time permitted. Robbins had six top-ten finishes in his career, with a personal-best top-five finish at the 1974 Motor State 360 in Michigan.

Robbins' cars were built and maintained by Cotton Owens. They were painted two-toned magenta and chartreuse, usually carrying car number 42 (though 6, 22, and 777 were also used). Over the years, he ran a few makes and models (Plymouths, Dodges, or Fords) before buying a 1972-bodied Dodge Charger from Owens. Robbins had a few major wrecks during the 1970s, and he had Owens rebuild the car to update the sheet metal to the 1973–1974 Charger specifications, and then finally 1978 Dodge Magnum sheet metal, which he raced until the end of 1980. Robbins' final NASCAR race car was a 1981 Buick Regal that he rented and drove in a few races in 1981 and 1982.

In 1972, at the Winston 500, Robbins stunned the competition by turning laps that were 15 mph faster than his qualifying time. After the race, NASCAR tried to bestow the Rookie of the Race award, but he would not accept it. He had knocked the NASCAR-mandated restrictors out of his carburetor and admitted he "just wanted to see what it was like to run up front for once."

Robbins is credited with possibly saving Richard Childress' life at the 1974 Charlotte 500 by deliberately crashing into a wall rather than T-bone (broadside) Childress's car that was stopped across the track.

In 1983, one year after Robbins' death, NASCAR honored him by naming the annual race at Fairgrounds Speedway the Marty Robbins 420.

Robbins' Dodge Magnum was restored by Owens and donated to the Talladega Museum by his family, and was displayed there from 1983 to 2008. The car is now in private hands in Southern California and raced on the Vintage NASCAR club circuit.

In 2014, Robbins' 1969 Dodge Charger Daytona was featured on an episode of Discovery Channels TV show Fast and Furious: Rolling Thunder. In that same year, an episode of Velocity's AmeriCarna featured ex-race team owner Ray Evernham spearheading the restoration of another of Robbins' NASCAR racers, a 1964 Plymouth Belvedere.

For the 2016 Darlington throwback weekend, Kyle Larson's number 42 NASCAR Xfinity Series car was painted purple and gold in honor of Robbins. For the 2021 Goodyear 400, Tyler Reddick's RCR number 8 NASCAR Cup car carries Robbins' signature magenta and chartreuse livery. For the 2022 running, Corey LaJoie's Spire Motorsports number 7 ran a throwback to Robbins' infamous 777 car that he ran in his career.

Personal life and death

In 1948, Robbins married Marizona Baldwin, who claimed she had always wanted to marry a singing cowboy. They had a son, Ronnie, and a daughter, Janet.

Robbins developed cardiovascular disease early in life, and suffered a first myocardial infarction in 1969. After his third heart attack on December 2, 1982, he underwent quadruple coronary artery bypass surgery. He did not recover, and died on December 8 at St. Thomas Hospital in Nashville. He was 57 years old.

Legacy

In 2015-2016, the city of Glendale, Arizona honored Marty Robbins in various ways. In 2015, a bronze plaque was placed along the amphitheater walkway. In 2016, the 1-mile stretch of Glendale Avenue, between 59th and 51st avenues was renamed to Marty Robbins Boulevard. Following the release of Fallout: New Vegas, Robbins' song "Big Iron" substantially increased in popularity and inspired internet memes.

Discography

Main article: Marty Robbins discography

Robbins' discography consists of 52 studio albums, 13 compilation albums, and 100 singles. In his career, Robbins charted 17 number-one singles on the Billboard Hot Country Songs charts, as well as 82 top-40 singles.

Robbins' highest-charting album is 1959's Gunfighter Ballads and Trail Songs. It charted to number six on the all-genre Billboard 200, and was also certified platinum by the Recording Industry Association of America. The album's first single, "El Paso", became a hit on both the country and pop charts, charting to number one on the Hot Country Songs, as well as the Billboard Hot 100. While that would be his only pop number one, in 1957, "A White Sport Coat" charted to number two, and in 1961, "Don't Worry" charted to number three.

His final top-10 single was "Honkytonk Man" from the 1982 eponymous film in which Robbins had a role. He died shortly before its release. Since his death, four posthumous studio albums have been released, but they made no impact on the charts.

Filmography

  • The Badge of Marshal Brennan (1957, 74 minutes) as Felipe, a Mexican outlaw
  • Raiders of Old California (1957, 72 minutes) as Timothy Voyle
  • Buffalo Gun (1958, released in 1961, 74 minutes) as Marty Robbins, a lawman
  • The Ballad of a Gunfighter (1963, 84 minutes) as Marty Robbins, an outlaw
  • Country Music Caravan (1964) as Himself, singing
  • Tennessee Jamboree (1964, 75 minutes) as Himself, singing
  • The Road to Nashville (1966, 109 minutes) as Himself, singing
  • Hell on Wheels (1967, 97 minutes) as Marty, a race car driver
  • From Nashville With Music (1969, 87 minutes) as Himself, singing
  • Country Music (1972, 93 minutes) as Himself, touring as singer, and as a race car driver
  • Guns of a Stranger (1973, 91 minutes) as Mathew Roberts
  • Honkytonk Man (1982, 122 minutes) as Smoky, a recording session singer

Motorsports career results

NASCAR

(key) (Bold – Pole position awarded by qualifying time. Italics – Pole position earned by points standings or practice time. * – Most laps led.)

Grand National Series

NASCAR Grand National Series resultsYearTeamNumberMake12345678910111213141516171819202122232425262728293031323334353637383940414243444546474849NGNCPtsRef1966David Warren53Ford122nd201968Dick Behling32Dodge78th01970Robbins Enterprises42Dodge94th57197169th120
AUGRSDDAYDAYDAYCARBRIATLHCYCLBGPSBGSNWSMARDARLGYMGRMONRCHCLTDTSASHPIFSMRAWSBLVGPSDAYODSBRROXFFONISPBRISMRNSV
25ATLCLBAWSBLVBGSDARHCYRCHHBOMARNWSCLTCAR
MGRMGYRSDDAYBRIRCHATLHCYGPSCLBNWSMARAUGAWSDARBLVLGYCLTASHMGRSMRBIRCARGPSDAYISPOXFFDATRNBRISMRNSVATLCLBBGSAWSSBOLGYDARHCYRCHBLVHBOMARNWSAUGCLT
12CARJFC
RSDDAYDAYDAYRCHCARSVHATLBRITALNWSCLBDARBLVLGYCLTSMRMARMCHRSDHCYKPTGPSDAYASTTPNTRNBRISMRNSVATLCLBONAMCHTALBGSSBODARHCYRCHDOVNCFNWSCLT
32MARMGRCARLGY
RSDDAYDAYDAYONTRCHCARHCYBRIATLCLBGPSSMRNWSMARDARSBOTALASHKPTCLT
15DOVMCHRSDHOUGPSDAYBRIASTISPTRNNSVATL
13BGSONAMCHTALCLBHCYDAR
7MARCLT
37DOVCARMGRRCHNWSTWS
25

Winston Cup Series

NASCAR Winston Cup Series resultsYearTeamNo.Make12345678910111213141516171819202122232425262728293031NWCCPtsRef1972Robbins Racing42Dodge54th860.8197383rd828.80197448th23.78197581st1211976NA197777th173197885th109197970th207366198071st204Warren Racing79M.C. Anderson Racing6Chevy1982Robbins Racing22Buick79th116
RSDDAYRCHONT
8CARATLBRIDARNWSMARTAL
50CLTDOVMCHRSDTWS
40DAYBRITRNATLTALMCHNSVDAR
9RCHDOVMARNWSCLTCAR
26TWS
RSDDAY
34RCHCARBRIATLNWSDARMARTALNSVCLTDOVTWS
29RSDMCHDAY
8BRIATLTAL
36NSVDARRCHDOVNWSMARCLTCAR
RSDDAYRCHCARBRIATLDARNWSMARTAL
15NSVDOVCLTRSDMCH
5DAYBRINSVATLPOCTAL
9MCHDARRCHDOVNWSMARCLT
42CARONT
RSDDAY
39RCHCARBRIATLNWSDARMARTAL
31NSVDOVCLTRSDMCHDAYNSVPOCTALMCHDARDOVNWSMARCLTRCHCARBRIATLONT
RSDDAYCARRCHBRIATLNWSDARMARTALNSVDOVCLTRSDMCHDAYNSVPOCTALMCHBRIDARRCHDOVMARNWSCLTCARATLONT
DNQ
RSDDAYRCHCARATLNWSDARBRIMARTALNSVDOVCLTRSDMCH
13DAYNSVPOCTAL
38MCHBRIDARRCHDOVMARNWSCLTCARATLONT
RSDDAYRCHCARATLBRIDARNWSMARTALDOVCLTNSVRSDMCHDAYNSVPOCTAL
18MCHBRIDARRCHDOVMARNWSCLTCARATLONT
RSDDAYCARRCHATLNWSBRIDARMARTALNSVDOVCLTTWSRSDMCH
35DAYNSVPOC
TAL
32
MCH
27BRIDARRCHDOVMARCLTNWSCARATLONT
RSDDAYRCHCARATLBRIDARNWSMARTAL
33NSVDOVCLTTWSRSDMCHTAL
13MCHBRIDARRCHDOVNWSMAR
DAY
30NSVPOC
CLT
32CARATLONT
DAYRCHBRIATLCARDARNWSMARTALNSVDOVCLTPOCRSDMCHDAY
37NSVPOCTALMCH
DNQBRIDARRCHDOVNWSCLTMARCARATL
33RSD

Daytona 500

YearTeamManufacturerStartFinish
1973Robbins RacingDodge3734
1975Robbins RacingDodge2839

References

Sources

  • Pruett, Barbara J. Marty Robbins: Fast Cars and Country Music. Lanham, MD: Scarecrow Press. 2007.
  • Diekman, Diane. Twentieth Century Drifter: The Life of Marty Robbins (Music in American Life). 2012.
  • Fallout: New Vegas – Big Iron is used on Radio New Vegas, Mojave Music Radio, and Black Mountain Radio.

References

  1. Fraser, Max. (2018). "Down in the Hole: Outlaw Country and Outlaw Culture". Southern Cultures.
  2. (2021). "Johnny Cash: The Last Interview: and Other Conversations". [[Melville House Publishing]].
  3. (August 12, 2020). "Marty Robbins".
  4. Pruett, Barbara J.. (2007). "Marty Robbins: Fast Cars and Country Music". Scarecrow Press.
  5. (2019-01-14). "Robert Matthew Heckle".
  6. (1929). "Rhymes of the Frontier".
  7. "Marty Robbins Obituary" December 8th 1982. ''The New York Times''.
  8. "Marty Robbins: Country Dude of Nashville. By Mary Harron: Articles, reviews and interviews from Rock's Backpages.".
  9. "Career Statistics". Racing-Reference.info.
  10. (1973-07-04). "1973 Medal of Honor Firecracker 400". Racing-Reference.info.
  11. "Hell on Wheels". IMDb.com.
  12. {{Pop Chronicles. 10. 2
  13. (1961). ["I told the brook [music] / by] Marty Robbins; arr. by Alec Baynes | National Library of Australia". Catalogue.nla.gov.au.
  14. (February 15, 2012). "Twentieth Century Drifter: The Life of Marty Robbins – Diane Diekman – Google Books". University of Illinois Press.
  15. Joel Whitburn's Top Country Singles 1944–2001
  16. "Domain parking page".
  17. [https://ktar.com/story/1290175/portion-of-glendale-avenue-renamed-for-legendary-country-singer/ "Portion of Glendale Avenue renamed for legendary country singer"]. [[KTAR-FM]], September 27, 2016.
  18. "Marty Robbins Obituary" December 10th 1982 The New York Times
  19. Meir, Kenneth. (February 2019). "Looking for Meaning in All the Wrong Places: Country Music and the Politics of Identity". Social Science Quarterly.
  20. "Marty Robbins and the Case for PC {{!}} ColumbusFreePress.com".
  21. Diekman, Diane. (2012). "Twentieth Century Drifter: The Life of Marty Robbins". University of Illinois Press.
  22. (June 16, 1974). "1974 Motor State 360". racing-reference.info.
  23. "Cotton Owens Garage – Drivers". Cotton Owens Garage and Stratatomic LLC.
  24. "Marty Robbins".
  25. (December 10, 1982). "Pereles, Jon, Marty Robbins, Singer, 57; Won a Grammy for 'El Paso', ''The New York Times'', December 10, 1982, Section D, page 17". The New York Times.
  26. Pareles, Jon. (1982-12-10). "Marty Robbins, Singer, 57; Won a Grammy for 'El Paso'". New York Times.
  27. Edmondson, John. (2015-10-22). "Glendale welcomes Marty Robbins home".
  28. "Glendale street-naming ceremony honors singer Marty Robbins". The Arizona Republic.
  29. Cichacki, Shaun. (2025-05-16). "I Know I'm 15 Years Late to the Party, but 'Fallout: New Vegas' May Have the Greatest Licensed Soundtrack Ever".
  30. [https://books.google.com/books?id=otDFSIwdsSIC&dq=%22Badge+of+Marshal+Brennan%22&pg=PA354 Barbara J. Pruett, ''Marty Robbins: Fast Cars and Country Music'', page 352-354, Scarecrow Press, 2007]
  31. [https://web.archive.org/web/20160126102117/http://www.tcm.com/tcmdb/person/162631%7C108222/Marty-Robbins/#filmography TCM Marty Robbins Films]
  32. [https://books.google.com/books?id=9z0vJTHfoCAC&dq=%22films+Marty+Robbins%22&pg=PA270 Sean Wilentz & Greil Marcus, ''The Rose & the Briar: Death, Love and Liberty in the American Ballad'', page 270, W.W. Norton, 2005]
  33. "Marty Robbins – 1966 NASCAR Grand National Series Results". NASCAR Digital Media, LLC.
  34. "Marty Robbins – 1968 NASCAR Grand National Series Results". NASCAR Digital Media, LLC.
  35. "Marty Robbins – 1970 NASCAR Grand National Series Results". NASCAR Digital Media, LLC.
  36. "Marty Robbins – 1971 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  37. "Marty Robbins – 1972 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  38. "Marty Robbins – 1973 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  39. "Marty Robbins – 1974 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  40. "Marty Robbins – 1975 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  41. "Marty Robbins – 1976 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  42. "Marty Robbins – 1977 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  43. "Marty Robbins – 1978 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  44. "Marty Robbins – 1979 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  45. "Marty Robbins – 1980 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
  46. "Marty Robbins – 1982 NASCAR Winston Cup Series Results". NASCAR Digital Media, LLC.
Wikipedia Source

This article was imported from Wikipedia and is available under the Creative Commons Attribution-ShareAlike 4.0 License. Content has been adapted to SurfDoc format. Original contributors can be found on the article history page.

Want to explore this topic further?

Ask Mako anything about Marty Robbins — get instant answers, deeper analysis, and related topics.

Research with Mako

Free with your Surf account

Content sourced from Wikipedia, available under CC BY-SA 4.0.

This content may have been generated or modified by AI. CloudSurf Software LLC is not responsible for the accuracy, completeness, or reliability of AI-generated content. Always verify important information from primary sources.

Report