Surf Wiki
Save to docs
general/neurotoxins

From Surf Wiki (app.surf) — the open knowledge base

Altitoxin

Neurotoxin

Altitoxin

Neurotoxin

Altitoxin is a neurotoxin found in the South African scorpion Parabuthus transvaalicus. Injection of altitoxin in mice leads to akinesia, depression and death.

Sources

South African spitting scorpion ''(Parabuthus transvaalicus)''

Altitoxin is secreted by the venom gland of the South African spitting (or fattail) scorpion Parabuthus transvaalicus.

Chemistry

Altitoxin, with the amino acid sequence ADVPGNYPLDKDGNTYTCLELGENKDCQKVCKLHGVQYGYCYAFFCWCKELDDKDVSV, is 58 amino acid residues long and has a molecular mass of 6598 Da; it has 3 disulfide bridges (Cys18-Cys41, Cys27-Cys46, and Cys31-Cys48). It has large homology to other toxins from the venom of Parabuthus transvaalicus, including bestoxin, birtoxin, ikitoxin and dortoxin.

Target

Altitoxin has sequence homology to scorpion β-toxins, suggesting it might target sodium channels. However, its depressing action following injection into mice is not in agreement with the effect of β-toxins on sodium channels. Related scorpion toxins, which include birtoxin and bestoxin, exhibit highly divergent biological activity, indicating that the mode of action of these toxins is highly diverse.

Toxicity

An injection of 100 ng altitoxin in 20 g mouse (ED99) causes a state of akinesia and depression. Lethality is reached at injecting 200 ng.

References

References

  1. (2005). "Three structurally related, highly potent, peptides from the venom of Parabuthus transvaalicus possess divergent biological activity". Toxicon.
Info: Wikipedia Source

This article was imported from Wikipedia and is available under the Creative Commons Attribution-ShareAlike 4.0 License. Content has been adapted to SurfDoc format. Original contributors can be found on the article history page.

neurotoxins ion-channel-toxins
Want to explore this topic further?

Ask Mako anything about Altitoxin — get instant answers, deeper analysis, and related topics.

Research with Mako

Free with your Surf account

Content sourced from Wikipedia, available under CC BY-SA 4.0.

This content may have been generated or modified by AI. CloudSurf Software LLC is not responsible for the accuracy, completeness, or reliability of AI-generated content. Always verify important information from primary sources.

Report