Skip to content
Surf Wiki
Save to docs
general/neurotoxins

From Surf Wiki (app.surf) — the open knowledge base

Agitoxin

Agitoxin

FieldValue
SymbolToxin_2
NameScorpion short toxin
image1agt.png
captionAgitoxin-2. Disulphide bonds are highlighted. PDB
PfamPF00451
Pfam_clanCL0054
InterProIPR001947
PROSITEPDOC00875
OPM family58
OPM protein3odv

Agitoxin is a toxin found in the venom of the scorpion Leiurus quinquestriatus hebraeus (yellow scorpion). Other toxins found in this species include charybdotoxin (CTX). CTX is a close homologue of Agitoxin.

Structure

Agitoxin can be purified using HPLC techniques.

Primary structure:

Three types of agitoxin can be distinguished, each identified as comprising 38 amino acids. They are highly homologous, differing only in the identity of the residues at positions 7, 15, 29 and 31.

Alignment of Agitoxins. Disulphide bonds are indicated beneath the alignment.
  • Agitoxin-1 Gly-Val-Pro-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK, molecular weight = 4014.87 Da, molecular formula = C169H278N52O47S7)
  • Agitoxin-2 Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK, molecular weight = 4090.95 Da, molecular formula = C169H278N54O48S8)
  • Agitoxin-3 Gly-Val-Pro-Ile-Asn-Val-Pro-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVPCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK, molecular weight = 4100.98 Da, molecular formula = C171H280N54O47S8, CAS Number 155646-23-4)

Secondary and tertiary structure:

Agitoxin consists of a triple-stranded antiparallel beta-sheet in which the C-terminal strand sits in the centre of the sheet, and a single alpha-helix covering one face of the beta-sheet (see image on the right). The cysteine side chains connect the beta-sheet and the helix via disulphide bonds to form the core of the molecule.

The fold of agitoxin is homologous to the previously determined folds of scorpion venom toxins, classified as 'Scorpion short toxins' by Pfam. This fold, and the location of the disulphide bonds, are a shared element between toxins stemming from arthropods. The structure of agitoxin-2, has been determined by NMR.

Function

Agitoxin binds to the Shaker K+ channel in Drosophila as well as to its mammalian homologue. It blocks this channel by binding with high affinity (Kd

This high affinity to the 'Shaker K' channel is dependent on the residues of Arg 24, Lys 27, and Arg 31. The ability of the agitoxin to block the 'Shaker K' channel suggests a docking mechanism whereby the toxin sits on the channel and then prevents its opening through flexible movements of the side chains thereby allowing for various protein-protein complexes to be enacted. AgTx2 has been found to undergo conformational changes when bound to the 'Shaker K' channel which suggests the induced fit model may be present in toxin-channel interaction. This mode of interaction goes along with and explains the flexible side chains. The amino acid make up of the toxin determines the way each interacts with Shaker K channels.

In Agitoxin, for example, the arginine interacts electrostatically with the aspartate of the 'Shaker K' channel. The final blocking of the pore in the Shaker K + channel occurs via the side chain of Lys 27. Lys 27 interacts with the Shaker K by plugging the selectivity filter and hydrogen bonding with carbonyls of Tyr 395 of each potassium channel subunit. Important stabilizing hydrogen bonding between various residues on the AgTx2 and the subunits of the channel hold the toxin-channel complex together. Mutations in Arg24Ala, Lys27Met, and Asn30Ala increased the dissociation, or break-down, of the complex, suggesting they all play important roles in holding the toxin on the channel.

References

References

  1. (August 1995). "Solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry". Protein Science.
  2. (December 1991). "Refined structure of charybdotoxin: common motifs in scorpion toxins and insect defensins". Science.
  3. (November 2002). "Modeling the structure of agitoxin in complex with the Shaker K+ channel: a computational approach based on experimental distance restraints extracted from thermodynamic mutant cycles". Biophysical Journal.
  4. (December 2002). "Virus replication and cytokine production in dengue virus-infected human B lymphocytes". Journal of Virology.
  5. (August 2003). "Interaction of agitoxin2, charybdotoxin, and iberiotoxin with potassium channels: selectivity between voltage-gated and Maxi-K channels". Proteins.
Wikipedia Source

This article was imported from Wikipedia and is available under the Creative Commons Attribution-ShareAlike 4.0 License. Content has been adapted to SurfDoc format. Original contributors can be found on the article history page.

Want to explore this topic further?

Ask Mako anything about Agitoxin — get instant answers, deeper analysis, and related topics.

Research with Mako

Free with your Surf account

Content sourced from Wikipedia, available under CC BY-SA 4.0.

This content may have been generated or modified by AI. CloudSurf Software LLC is not responsible for the accuracy, completeness, or reliability of AI-generated content. Always verify important information from primary sources.

Report